PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OBART01G04450.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family MYB
Protein Properties Length: 283aa    MW: 30429 Da    PI: 5.4243
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OBART01G04450.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding28.14.8e-092581148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT.........TTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmg.........kgRtlkqcksrwqkyl 48
                     +g W++eEde+l+  ++  G  tW+++   +          ++R++k+c++rw +yl
  OBART01G04450.1 25 KGLWSPEEDERLYTHITHRGVSTWSSVIWFLDltrlalhlrLRRSGKSCRLRWMNYL 81
                     678*******************6666555555555555555**************97 PP

2Myb_DNA-binding414.5e-1390129445
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       +  E e ++ + k+lG++ W+ Ia++m+ gRt++++k++w+
  OBART01G04450.1  90 ISDREAETIISLQKLLGNR-WSVIAAKMP-GRTDNEIKNYWN 129
                      577899*************.*********.***********9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.2752081IPR017930Myb domain
SuperFamilySSF466892.7E-2324128IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-172480IPR009057Homeodomain-like
SMARTSM007172.7E-42483IPR001005SANT/Myb domain
PfamPF002493.8E-72581IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.7E-2281135IPR009057Homeodomain-like
PROSITE profilePS5129420.55282136IPR017930Myb domain
SMARTSM007173.8E-1286134IPR001005SANT/Myb domain
CDDcd001671.03E-889129No hitNo description
PfamPF002491.0E-1091130IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MVRKPTSSRH GEAAGGGAAE EKERKGLWSP EEDERLYTHI THRGVSTWSS VIWFLDLTRL  60
ALHLRLRRSG KSCRLRWMNY LRPDLKKEPI SDREAETIIS LQKLLGNRWS VIAAKMPGRT  120
DNEIKNYWNS RIRKRQSAAA GSGGCPTPGT VMEKEPTANA ATVAAAPEAA SPPPPPIPAR  180
LPMFSCQLLD GGGGGAATTQ SPPNAGSSDI SEVSACGGNG GGEDSSRDYC FSGGDVDGDG  240
DMVHLLALDD LDLLVDVPGL LDVDAWDCEL YRADYSTSSS MSN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C1e-222513527127MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0029120.0AP002912.2 Oryza sativa Japonica Group genomic DNA, chromosome 1, PAC clone:P0028E10.
GenBankAP0033390.0AP003339.4 Oryza sativa Japonica Group genomic DNA, chromosome 1, BAC clone:OJ1276_B06.
GenBankAP0149570.0AP014957.1 Oryza sativa Japonica Group DNA, chromosome 1, cultivar: Nipponbare, complete sequence.
GenBankAY4593430.0AY459343.1 Oryza sativa (japonica cultivar-group) clone CL018501.1 R2R3-MYB gene region.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015694952.11e-121PREDICTED: myb-related protein Hv33-like
TrEMBLA0A0D3EK220.0A0A0D3EK22_9ORYZ; Uncharacterized protein
STRINGORGLA01G0040600.11e-155(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP87032545
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G09540.11e-36myb domain protein 61